β-Amyloid (1-42), Scrambled

Cat.No.：NP020605-ABT42-S

Description：Scrambled Beta-Amyloid 1-42 peptide is the sequence-randomized negative control for wild-type human Aβ1-42.

Product Name：β-Amyloid (1-42), Scrambled
Synonym：Scrambled Aβ1-42, Scrambled Amyloid beta 1-42, β-Amyloid (1-42) scrambled peptide, Aβ 1-42 negative control peptide, Random sequence Aβ1-42, Non-amyloidogenic Aβ1-42 variant, Scrambled beta-amyloid 1-42 control, Aβ1-42 non-aggregating control peptide
Sequence：AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Cas No.：1678415-52-5
Molecular Weight：4514.14
Price (USD)：$400.00/5mg; $650.00/10mg

All products are for scientific research purposes only and cannot be used for personal purposes.

Bioactivity:	Scrambled beta-Amyloid (1-42) functions as a critical negative control in amyloid beta research. While it shares the exact same amino acid composition as wild-type human A beta 1-42 (42 residues), the randomized sequence disrupts the hydrophobic LVFFA core (residues 17-21) responsible for beta-sheet-driven self-assembly. As a result, this scrambled variant does not form amyloid fibrils, does not generate toxic oligomers, and exhibits no significant neurotoxicity toward primary hippocampal neurons. It also lacks binding affinity for key A beta 1-42 receptor targets including neuronal PrPC, LRP1, and NMDA receptors.
Three-letter Sequence:	Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala
Appearance:	Lyophilized yellow power
Counter Ion:	TFA
Storage:	Power: -20°C(1 year) or -80°C(1~2 years)
Reconstitution:	Acetic acid/water (3:2) or DMSO
Shipping:	All peptides will be shipped as lyophilized powder with desiccant at room temperature.

Currently, there is no literature available.

Currently, there are no Q&A available